PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10016289m
Common NameCARUB_v10016289mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 240aa    MW: 27371.6 Da    PI: 7.2067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10016289mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.7e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eE e+l   +++ G ++W++ ++  g+ R++k+c++rw +yl
  Carubv10016289m 16 RGPWSDEESERLRAFIEKNGHHNWRSLPKLAGLMRCGKSCRLRWINYL 63
                     89********************************************97 PP

2Myb_DNA-binding55.51.3e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ ++++++ +G++ W++Ia++++ gRt++++k+ w+++l
  Carubv10016289m  69 RGNFTKEEEDTIIHLHQAHGNK-WSKIASHFP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1331163IPR017930Myb domain
SuperFamilySSF466891.27E-2914110IPR009057Homeodomain-like
SMARTSM007174.5E-101565IPR001005SANT/Myb domain
PfamPF002492.8E-131663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-211770IPR009057Homeodomain-like
CDDcd001675.15E-81863No hitNo description
PROSITE profilePS5129425.44264118IPR017930Myb domain
SMARTSM007174.5E-1668116IPR001005SANT/Myb domain
PfamPF002491.5E-1669114IPR001005SANT/Myb domain
CDDcd001677.87E-1171114No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2871118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGKKRAPCCD KSQVRRGPWS DEESERLRAF IEKNGHHNWR SLPKLAGLMR CGKSCRLRWI  60
NYLRPGLKRG NFTKEEEDTI IHLHQAHGNK WSKIASHFPG RTDNEIKNVW NTHLKKRLMK  120
SNSLSSSSDA TNQSLSSTSS SSSSISSVLK DVIRSSEKPN QEEEFEEILV EQIACGFEVN  180
APQSLECLFE DSHIPPPTSK PDLLEINGKS DNEFWSRLLV EPGFDDYNEW LNFLDNQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22161187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00352DAPTransfer from AT3G12820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195860.0AY519586.1 Arabidopsis thaliana MYB transcription factor (At3g12820) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300061.11e-177hypothetical protein CARUB_v10016289mg
SwissprotP200244e-59MYB1_MAIZE; Myb-related protein Zm1
TrEMBLR0HT361e-177R0HT36_9BRAS; Uncharacterized protein
STRINGAT3G12820.11e-135(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140961624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12820.11e-127myb domain protein 10